HORDB

ID: hor004624
Uniprot ID: O49519(64-75)
Protein name: CLE2p
Gene name: CLE2
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: CLV3/ESR signal peptide family
Source: Plant
Expression: [CLE2p]: Mostly expressed in roots and seedlings, and, to a lower extent, in apex.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0007267 cell-cell signaling; GO:0030154 cell differentiation; GO:0045165 cell fate commitment
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: RLSPGGPDPQHH
Length: 12(64-75)
Propeptide: MAKLSFTFCFLLFLLLSSIAAGSRPLEGARVGVKVRGLSPSIEATSPTVEDDQAAGSHGKSPERLSPGGPDPQHH
Signal peptide: MAKLSFTFCFLLFLLLSSIAAG
Modification: T4 Hydroxyproline;T7 Hydroxyproline
Glycosylation: T7 O-linked (Ara...) hydroxyproline
Mutagenesis: NA

Function: Extracellular signal peptide that regulates cell fate. May act with CLV1 as a ligand-receptor pair in a signal transduction pathway, coordinating growth between adjacent meristematic regions. {ECO:0000269|PubMed:16489133, ECO:0000269|PubMed:19525968}.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004624_AF2.pdb

hor004624_ESM.pdb

Mass:	149378	Formula:	C55H84N20O17
Absent amino acids:	ACEFIKMNTVWY	Common amino acids:	P
pI:	7.71	Basic residues:	3
Polar residues:	3	Hydrophobic residues:	1
Hydrophobicity:	-170.83	Boman Index:	-3510
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	32.5
Instability Index:	6583.33	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 18315543
Title: Identification of a Biologically Active, Small, Secreted Peptide in Arabidopsis by in Silico Gene Screening, Followed by LC-MS-based Structure Analysis